Home Productsoctapeptide 2 online manufacturer
Certification
China Chengdu YoungShe Chemical Co.,Ltd certification
I'm Online Chat Now

octapeptide 2 online manufacture

(1000)
buy GHRP-2 Acetate CAS:158861-67-7 online manufacturer

GHRP-2 Acetate CAS:158861-67-7

Product Information Name: GHRP-2 Acetate Cas No: 158861-67-7 Formula: C45H55N9O6 Molecular:818 Sequence: Ala-beta-Nal-Ala-Trp-Phe-Lys-NH2 Purity:98% Appearance: white powder Source: synthetic Also-known-as: ... Read More
2023-11-08 16:17:31
buy Linaclotide Acetate CAS:851199-59-2 online manufacturer

Linaclotide Acetate CAS:851199-59-2

Product Information Name:Linaclotide Acetate Cas No:851199-59-2 Formula: C61H83N15O23S6 Molecular: 1586.78 Sequence: Cys cys glu tyr cys cys asn pro ala cys thr gly cys tyr (disulfide bridge: 1-6; 2-10; 5-13) ... Read More
2023-11-09 11:00:23
buy Pentagastrin CAS: 5534-95-2 online manufacturer

Pentagastrin CAS: 5534-95-2

Product Information 1.Basic information: Name: Pentagastrin Cas No: 5534-95-2 Formula: C37H49N7O9S Molecular:767.9 Sequence: Boc--Ala-Trp-Met-Asp-Phe-NH2 Purity:98% Appearance: white powder Source: synthetic 2... Read More
2023-11-09 11:48:09
buy Teduglutide CAS:197922-42-2 peptide powder online manufacturer

Teduglutide CAS:197922-42-2 peptide powder

Product Information Name: Teduglutide Cas No: 197922-42-2 Formula: C164H252N44O55S Molecular:3752 Sequence: HGDGSFSDEMNTILDNLAARDFINWLIQTKITD Purity:98% Appearance: white powder Source: synthetic Also known as: ... Read More
2023-11-09 15:19:00
buy Semaglutide 99% Purity CAS:910463-68-2 Quality Peptide with Factory Price online manufacturer

Semaglutide 99% Purity CAS:910463-68-2 Quality Peptide with Factory Price

Product Information Name: Semaglutide CAS No. : 910463-68-2 Sequence: His-Aib-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-N6-[N-(17-carboxy-1-oxoheptadecyl-L--glutamyl[2-(2-aminoethoxy... Read More
2025-09-08 16:15:31
buy Teduglutide CAS:197922-42-2 online manufacturer

Teduglutide CAS:197922-42-2

Product Information Name: Teduglutide CAS No. : 197922-42-2 Sequence: His-Gly-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp ... Read More
2023-11-10 16:54:45
buy Tirzepatide CAS:2023788-19-2 Quality Peptide Pure White Powder 99% Purity online manufacturer

Tirzepatide CAS:2023788-19-2 Quality Peptide Pure White Powder 99% Purity

Product InformationName:TirzepatideCAS:2023788-19-2Sequence:Tyr-{Aib}-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Ile-{Aib}-Leu-Asp-Lys-Ile-Ala-Gln-{diacid-C20-gamma-Glu-(AEEA)2-Lys}-Ala-Phe-Val-Gln-Trp-Leu-Ile-Ala-Gly... Read More
2025-09-08 16:19:21
buy sh-Polypeptide-1 rh-Polypeptide-1 bFGF FGF-2 online manufacturer

sh-Polypeptide-1 rh-Polypeptide-1 bFGF FGF-2

Product Information Product Name: Recombinant Human Fibroblast Growth Factor-basic (rh-bFGF) INCI Name:sh-Polypeptide-1/rh-Polypeptide-1 Packing Details: 1mg, 10mg or customized Mol. Wt.: 17.2 kDa Resources: ... Read More
2023-11-13 14:36:55
buy Trifluoroacetyl Tripeptide-2 Cas No: 64577-63-5 online manufacturer

Trifluoroacetyl Tripeptide-2 Cas No: 64577-63-5

Product Information 1.Basic information: INCI Name: Trifluoroacetyl Tripeptide-2 Synonym: ECM-Protect, Progeline Cas No: 64577-63-5 Formula: C21H28F3N3O6 Molecular:475.47 Stability: stable Odor: no Grade: ... Read More
2023-11-21 15:22:01
buy (Des-His⁶)-ACTH (1-24) (human, bovine, rat)  CAS:1926163-11-2 online manufacturer

(Des-His⁶)-ACTH (1-24) (human, bovine, rat) CAS:1926163-11-2

Product Information *title CAS No. *Keyword1 Keyword2 Keyword3 Molecular Formula Molecular Weight Sequence (Des-His)-ACTH (1-24) (human, bovine, rat) 1926163-11-2 (Des-His)-Tetracosactide 1926163-11-2 ACTH (1... Read More
2024-03-13 11:38:11
Page 8 of 100|< 3 4 5 6 7 8 9 10 11 12 >|