|
Product Details:
|
| Apperance: | White Powder | Shelf Life: | 2 Years |
|---|---|---|---|
| Purity: | 95%~99% |
Product Information
Name: Teduglutide
Cas No: 197922-42-2
Formula: C164H252N44O55S
Molecular:3752
Sequence: HGDGSFSDEMNTILDNLAARDFINWLIQTKITD
Purity:98%
Appearance: white powder
Source: synthetic
Also known as: Gattex, ALX-0600, (Gly2)GLP-2, Gly(2)-GLP-2, ALX 0600, [Gly2]GLP-2
| Shelf Life | 2 years |
| Apperance | White Powder |
| Purity(by HPLC) | ≥95% |
| Hot-sell peptide | |
| BPC157 | Semaglutide |
| TB500 | Tirze patide |
| Thymosin beta 4 (TB4) | Reta trutide |
| GHRP-2 | Bronchogen (Ala-Glu-Asp-Leu) |
| GHRP-6 | Cardiogen (Ala-Glu-Asp-Arg) |
| KPV | Cortagen (Ala-Glu-Asp-Pro) |
| CJC-1295 with DAC | Livagen (Lys-Glu-Asp-Ala) |
| CJC-1295 without DAC | Pancragen (Lys-Glu-Asp-Trp) |
| Ipamorelin | Prostamax (Lys-Glu-Asp-Pro) |
| Tesamorelin | Testagen (Lys-Glu-Asp-Gly) |
| DSIP | Cartalax (Ala-Glu-Asp) |
| AOD9604 | Chonluten (Glu-Asp-Gly) |
| HGH176-191 | Crystagen (Glu-Asp-Pro) |
| Semax | Ovagen (Glu-Asp-Leu) |
| NA-Semax | Vesugen (Lys-Glu-Asp) |
| NA-Semax Amidate | Pinealon (Glu-Asp-Arg) |
| Selank | Vesilute (Glu-Asp) ED |
| NA-Selank | Vilon(Lys-Glu) KE |
| NA-Selank Amidate | Thymogen(Glu-Trp)Thymagen |
| Epitalon | Thymopentin |
| NA-Epitalon | PEG-MGF |
| NA-Epitalon Amidate | RGD peptide |
| SS-31 | Humanin(HNG peptide) |
| ARA290 | DNSP-11 |
| MIF-1 | ACE-167 |
| Larazotide | Kisspeptin-10 |
| Thymulin/Thymalin | Epobis |
| Zinc Thymulin | Davunetide |
| Dihexa Peptide | Valorphin |
| MOTS-c | Goralatide/Ac-SDKP |
| Sermorelin(GRF1-29) | Normoftal |
| Melanotan2/MT2 | Mazdutide |
| Melanotan1/MT1 | Cagrilintide |
| PT141 | Human ezrin peptide/Gepon |
| GLYX-13 | PE22-28 |
| P21 peptide | Survodutide |
| Orexin-A Peptide | Dermorphin |
| GcMAF peptide | HIV-1 TAT Protein Peptide |
| Colivelin | beta-Endorphin |
| Oxytocin | alpha-Endorphin |
| Thymosin a1 | Abaloparatide |
| VIP | Deslorelin |
Company Information
This product is stable for 24 months from date of manufacture at -20℃ to -15℃ in a freezer.
Protected from light, keep package airproofed when not in use.
![]()
Company Information
Chengdu Youngshe Chemical Co.,Ltd, is a dynamic and progressive peptides manufacturer in China. We are dedicating to be a professional, efficient,and reliable partner for global customers on peptides.Hi-new tech Zone campus in the suburb of Chengdu city provides Youngshe with a good infrastructure for both industrial-scale production of peptides and custom peptide synthesis.You can select more than 200 kinds of raw cosmetic peptide ingredients here.Youngshe provide a one-stop service for raw cosmetic peptide ingredients.You will save lots of time ,energy, money and have a very pleasant experience with us.
![]()
Our Exhibition
![]()
Our Advantages
1.Competitive factory price.
2. Professionalism of production: With more than 10 years of experience in peptide production
3. Professionalism of product efficacy: We are familiar with thousands of peptides that are now available worldwide, thorough research.
4. Professionalism of service:customer satisfaction is our greatest work.
5. Reliability: We always believe that only good reputation and product quality can make a good company.
6. Flexibility:We offer a variety of peptides, liquid, freeze-dried powder etc.
7. Variety of products: We offer more than 200 cosmetic peptides, including Dipeptide, Tripeptide, Tetrapeptide, Pentapeptide, Hexapeptide, Heptapeptide, Octapeptide, Nonapeptide, Decapeptide, Copper peptide, Oligopeptide and so on.
![]()
Packing&Shipping
![]()
F&Q
Q1: How do I make an order?
A: Simply send an inquiry to contact with us and we will be happy to assist you with your order.
Q2: How to start orders or make payments?
A: Proforma invoice will be sent first after confirmation of order, enclosed our bank information.We accept T/T (Telegraphic
Transfer),credit card or Paypal.
Q3: How about delivery lead time?
A:Delivery lead time: About 3-7 days after payment confirmed. (Chinese holiday not included)
Q4:Is there a discount?
A:Different quantity has different discount.
Q5: How do you treat quality complaint?
A:First of all, our quality control will reduce the quality problem to near zero. If there is a real quality problem caused by us,
we will send you free goods for replacement or refund your loss.
Contact info.
Aileen Chen
Email: aileen@youngshechem.com
WhatsApp/Telegram/WeChat: +8619150309904
Contact Person: Ms. Aileen Chen
Tel: +8619150309904
Fax: 86-28-62328193