Home Productspeptides intermediates

CRF (human,rat) CAS:9002-60-2 Custom Peptide Synthesis

Certification
china Chengdu YoungShe Chemical Co.,Ltd certification
I'm Online Chat Now

CRF (human,rat) CAS:9002-60-2 Custom Peptide Synthesis

CRF (human,rat) CAS:9002-60-2 Custom Peptide Synthesis
CRF (human,rat) CAS:9002-60-2 Custom Peptide Synthesis CRF (human,rat) CAS:9002-60-2 Custom Peptide Synthesis CRF (human,rat) CAS:9002-60-2 Custom Peptide Synthesis CRF (human,rat) CAS:9002-60-2 Custom Peptide Synthesis

Large Image :  CRF (human,rat) CAS:9002-60-2 Custom Peptide Synthesis

Product Details:
Place of Origin: China
Brand Name: YS
Certification: ISO9001
Model Number: YSCP
Payment & Shipping Terms:
Minimum Order Quantity: 1G
Price: negotiable
Packaging Details: 1g/bottle, 10g/bottle, 100g/bottle or customized
Delivery Time: 5 days
Payment Terms: T/T
Supply Ability: bulk

CRF (human,rat) CAS:9002-60-2 Custom Peptide Synthesis

Description
Apperance: White Powder Shelf Life: 2 Years
Purity: 95%~99%

Product Information

 

Name: CRF(human,rat),Corticotropin releasing factor

Cas No: 86784-80-7

Formula: C208H344N60O63S2

Molecular: 4757.45

Sequence:H-Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH₂

Purity:98%

Appearance: white powder

Source: synthetic

 

Also know as Corticoliberin, Corticorelin, CRF-41, CRH

CRF (corticotropin-releasing factor) is a 41-peptide produced mainly in the hypothalamus. The peptide hormone stimulates ACTH release from the anterior lobe of the pituitary gland. CRF plays an important role in the endocrine, behavioral, and immune response to stress and probably as well in the regulation of energy balance.
The human sequence EEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII amide also corresponds to the sequence of canine, feline, murine, and porcine CRF.

 

Note: For lab research use only

 

 

Shelf Life  2 years
Apperance  White Powder
Purity(by HPLC)  ≥95%

 

 

 

Hot-sell peptide
BPC157 Semaglutide
TB500 Tirze patide
Thymosin beta 4 (TB4) Reta trutide
GHRP-2 Bronchogen (Ala-Glu-Asp-Leu)
GHRP-6 Cardiogen (Ala-Glu-Asp-Arg)
KPV Cortagen (Ala-Glu-Asp-Pro)
CJC-1295 with DAC Livagen (Lys-Glu-Asp-Ala)
CJC-1295 without DAC Pancragen (Lys-Glu-Asp-Trp)
Ipamorelin Prostamax (Lys-Glu-Asp-Pro)
Tesamorelin Testagen (Lys-Glu-Asp-Gly)
DSIP Cartalax (Ala-Glu-Asp)
AOD9604 Chonluten (Glu-Asp-Gly)
HGH176-191 Crystagen (Glu-Asp-Pro)
Semax Ovagen (Glu-Asp-Leu)
NA-Semax Vesugen (Lys-Glu-Asp)
NA-Semax Amidate Pinealon (Glu-Asp-Arg)
Selank Vesilute (Glu-Asp) ED
NA-Selank Vilon(Lys-Glu) KE
NA-Selank Amidate Thymogen(Glu-Trp)Thymagen
Epitalon Thymopentin
NA-Epitalon PEG-MGF
NA-Epitalon Amidate RGD peptide
SS-31 Humanin(HNG peptide)
ARA290 DNSP-11
MIF-1 ACE-167
Larazotide Kisspeptin-10
Thymulin/Thymalin Epobis
Zinc Thymulin Davunetide
Dihexa Peptide Valorphin
MOTS-c Goralatide/Ac-SDKP
Sermorelin(GRF1-29) Normoftal
Melanotan2/MT2 Mazdutide
Melanotan1/MT1 Cagrilintide
PT141 Human ezrin peptide/Gepon
GLYX-13 PE22-28
P21 peptide Survodutide
Orexin-A Peptide Dermorphin
GcMAF peptide HIV-1 TAT Protein Peptide
Colivelin beta-Endorphin
Oxytocin alpha-Endorphin
Thymosin a1 Abaloparatide
VIP Deslorelin

 

 

Company Information

This product is stable for 24 months from date of manufacture at -20℃ to -15℃ in a freezer.
Protected from light, keep package airproofed when not in use.

CRF (human,rat) CAS:9002-60-2 Custom Peptide Synthesis 0


Company Information


Chengdu Youngshe Chemical Co.,Ltd, is a dynamic and progressive peptides manufacturer in China. We are dedicating to be a professional, efficient,and reliable partner for global customers on peptides.Hi-new tech Zone campus in the suburb of Chengdu city provides Youngshe with a good infrastructure for both industrial-scale production of peptides and custom peptide synthesis.You can select more than 200 kinds of raw cosmetic peptide ingredients here.Youngshe provide a one-stop service for raw cosmetic peptide ingredients.You will save lots of time ,energy, money and have a very pleasant experience with us.
CRF (human,rat) CAS:9002-60-2 Custom Peptide Synthesis 1

Our Exhibition

CRF (human,rat) CAS:9002-60-2 Custom Peptide Synthesis 2

Our Advantages


1.Competitive factory price.
2. Professionalism of production: With more than 10 years of experience in peptide production
3. Professionalism of product efficacy: We are familiar with thousands of peptides that are now available worldwide, thorough research.
4. Professionalism of service:customer satisfaction is our greatest work.
5. Reliability: We always believe that only good reputation and product quality can make a good company.
6. Flexibility:We offer a variety of peptides, liquid, freeze-dried powder etc.
7. Variety of products: We offer more than 200 cosmetic peptides, including Dipeptide, Tripeptide, Tetrapeptide, Pentapeptide, Hexapeptide, Heptapeptide, Octapeptide, Nonapeptide, Decapeptide, Copper peptide, Oligopeptide and so on.

CRF (human,rat) CAS:9002-60-2 Custom Peptide Synthesis 3

Packing&Shipping
CRF (human,rat) CAS:9002-60-2 Custom Peptide Synthesis 4
F&Q


Q1: How do I make an order?
A: Simply send an inquiry to contact with us and we will be happy to assist you with your order.


Q2: How to start orders or make payments?
A: Proforma invoice will be sent first after confirmation of order, enclosed our bank information.We accept T/T (Telegraphic
Transfer),credit card or Paypal.


Q3: How about delivery lead time?
A:Delivery lead time: About 3-7 days after payment confirmed. (Chinese holiday not included)


Q4:Is there a discount?
A:Different quantity has different discount.


Q5: How do you treat quality complaint?
A:First of all, our quality control will reduce the quality problem to near zero. If there is a real quality problem caused by us,
we will send you free goods for replacement or refund your loss.


Contact info.


Aileen Chen
Email: aileen@youngshechem.com
WhatsApp/Telegram/WeChat: +8619150309904

 

Contact Details
Chengdu YoungShe Chemical Co.,Ltd

Contact Person: Ms. Aileen Chen

Tel: +8619150309904

Fax: 86-28-62328193

Send your inquiry directly to us (0 / 3000)