Certification
China Chengdu YoungShe Chemical Co.,Ltd certification
I'm Online Chat Now

Sermorelin

Sermorelin
Sermorelin Sermorelin Sermorelin Sermorelin

Large Image :  Sermorelin

Product Details:
Place of Origin: China
Brand Name: YS
Certification: ISO9001
Model Number: YSCP
Payment & Shipping Terms:
Minimum Order Quantity: 1G
Price: negotiable
Packaging Details: 1g/bottle, 10g/bottle, 100g/bottle or customized
Delivery Time: 5 days
Payment Terms: T/T,Paypal,Western Union,Money Gram
Supply Ability: bulk

Sermorelin

Description
Apperance: White Powder Shelf Life: 2 Years
Purity: 95%~99%

Product Information

 

Name: Sermorelin Acetate

Cas No: 86168-78-7(net),114466-38-5(acetate)

Formula: C151H250N44O44S

Molecular:3417

Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQ

Purity:98%

Appearance: white powder

Source: synthetic

Also known as: Geref, UNII-00IBG87IQW,AN-33322,GRF(1-29), GHRH(1-29), Serono Brand of Sermorelin, Sermorelina, Sermorelinum, Geref (TN), Sermoreline [French].

 

 

 

 

Shelf Life  2 years
Apperance  White Powder
Purity(by HPLC)  ≥95%

 

Company Information
 
Chengdu Youngshe Chemical Co.,Ltd, is a dynamic and progressive peptides manufacturer in China. We are dedicating to be a professional, efficient,and reliable partner for global customers on peptides.Hi-new tech Zone campus in the suburb of Chengdu city provides Youngshe with a good infrastructure for both industrial-scale production of peptides and custom peptide synthesis.You can select more than 200 kinds of raw cosmetic peptide ingredients here.Youngshe provide a one-stop service for raw cosmetic peptide ingredients.You will save lots of time ,energy, money and have a very pleasant experience with us.
Sermorelin 0
 
Our Advantages
 
1.Competitive factory price.
2. Professionalism of production: With more than 10 years of experience in peptide production
3. Professionalism of product efficacy: We are familiar with thousands of peptides that are now available worldwide, thorough research.
4. Professionalism of service:customer satisfaction is our greatest work.
5. Reliability: We always believe that only good reputation and product quality can make a good company.
6. Flexibility:We offer a variety of peptides, liquid, freeze-dried powder etc.
7. Variety of products: We offer more than 200 cosmetic peptides, including Dipeptide, Tripeptide, Tetrapeptide, Pentapeptide, Hexapeptide, Heptapeptide, Octapeptide, Nonapeptide, Decapeptide, Copper peptide, Oligopeptide and so on.
 
Packing&Shipping
Sermorelin 1
 
F&Q
 
Q1: How do I make an order?
A: Simply send an inquiry to contact with us and we will be happy to assist you with your order.


Q2: How to start orders or make payments?
A: Proforma invoice will be sent first after confirmation of order, enclosed our bank information.We accept T/T (Telegraphic
Transfer),Western Union or Paypal.


Q3: How about delivery lead time?
A:Delivery lead time: About 3-5 days after payment confirmed. (Chinese holiday not included)


Q4:Is there a discount?
A:Different quantity has different discount.


Q5: How do you treat quality complaint?
A:First of all, our quality control will reduce the quality problem to near zero. If there is a real quality problem caused by us,
we will send you free goods for replacement or refund your loss.

 
 
Contact info.
Aileen Chen
Email: aileen@youngshechem.com
Tel/whatsapp/Skype/WeChat: +8619150309904

Contact Details
Chengdu YoungShe Chemical Co.,Ltd

Contact Person: Ms. Aileen Chen

Tel: +8619150309904

Fax: 86-28-62328193

Send your inquiry directly to us (0 / 3000)