Home Productspeptides intermediates

Sermorelin CAS:86168-78-7 peptide on sale GRF(1-29)

Certification
china Chengdu YoungShe Chemical Co.,Ltd certification
I'm Online Chat Now

Sermorelin CAS:86168-78-7 peptide on sale GRF(1-29)

Sermorelin CAS:86168-78-7 peptide on sale GRF(1-29)
Sermorelin CAS:86168-78-7 peptide on sale GRF(1-29) Sermorelin CAS:86168-78-7 peptide on sale GRF(1-29) Sermorelin CAS:86168-78-7 peptide on sale GRF(1-29) Sermorelin CAS:86168-78-7 peptide on sale GRF(1-29)

Large Image :  Sermorelin CAS:86168-78-7 peptide on sale GRF(1-29)

Product Details:
Place of Origin: China
Brand Name: YS
Certification: ISO9001
Model Number: YSCP
Payment & Shipping Terms:
Minimum Order Quantity: 1G
Price: negotiable
Packaging Details: 1g/bottle, 10g/bottle, 100g/bottle or customized
Delivery Time: 5 days
Payment Terms: T/T
Supply Ability: bulk

Sermorelin CAS:86168-78-7 peptide on sale GRF(1-29)

Description
Apperance: White Powder Shelf Life: 2 Years
Purity: 95%~99%

Product Information

 

Name: Sermorelin Acetate

Cas No: 86168-78-7

Formula: C151H250N44O44S

Molecular:3417

Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQ

Purity:98%

Appearance: white powder

Source: synthetic

Also known as: Geref, UNII-00IBG87IQW,AN-33322,GRF(1-29), GHRH(1-29), Serono Brand of Sermorelin, Sermorelina, Sermorelinum, Geref (TN), Sermoreline [French].

 

 

Shelf Life  2 years
Apperance  White Powder
Purity(by HPLC)  ≥95%

 

 

 

 

Hot-sell peptide
BPC157 Semaglutide
TB500 Tirze patide
Thymosin beta 4 (TB4) Reta trutide
GHRP-2 Bronchogen (Ala-Glu-Asp-Leu)
GHRP-6 Cardiogen (Ala-Glu-Asp-Arg)
KPV Cortagen (Ala-Glu-Asp-Pro)
CJC-1295 with DAC Livagen (Lys-Glu-Asp-Ala)
CJC-1295 without DAC Pancragen (Lys-Glu-Asp-Trp)
Ipamorelin Prostamax (Lys-Glu-Asp-Pro)
Tesamorelin Testagen (Lys-Glu-Asp-Gly)
DSIP Cartalax (Ala-Glu-Asp)
AOD9604 Chonluten (Glu-Asp-Gly)
HGH176-191 Crystagen (Glu-Asp-Pro)
Semax Ovagen (Glu-Asp-Leu)
NA-Semax Vesugen (Lys-Glu-Asp)
NA-Semax Amidate Pinealon (Glu-Asp-Arg)
Selank Vesilute (Glu-Asp) ED
NA-Selank Vilon(Lys-Glu) KE
NA-Selank Amidate Thymogen(Glu-Trp)Thymagen
Epitalon Thymopentin
NA-Epitalon PEG-MGF
NA-Epitalon Amidate RGD peptide
SS-31 Humanin(HNG peptide)
ARA290 DNSP-11
MIF-1 ACE-167
Larazotide Kisspeptin-10
Thymulin/Thymalin Epobis
Zinc Thymulin Davunetide
Dihexa Peptide Valorphin
MOTS-c Goralatide/Ac-SDKP
Sermorelin(GRF1-29) Normoftal
Melanotan2/MT2 Mazdutide
Melanotan1/MT1 Cagrilintide
PT141 Human ezrin peptide/Gepon
GLYX-13 PE22-28
P21 peptide Survodutide
Orexin-A Peptide Dermorphin
GcMAF peptide HIV-1 TAT Protein Peptide
Colivelin beta-Endorphin
Oxytocin alpha-Endorphin
Thymosin a1 Abaloparatide
VIP Deslorelin

 

 

Company Information

This product is stable for 24 months from date of manufacture at -20℃ to -15℃ in a freezer.
Protected from light, keep package airproofed when not in use.

Sermorelin CAS:86168-78-7 peptide on sale GRF(1-29) 0


Company Information


Chengdu Youngshe Chemical Co.,Ltd, is a dynamic and progressive peptides manufacturer in China. We are dedicating to be a professional, efficient,and reliable partner for global customers on peptides.Hi-new tech Zone campus in the suburb of Chengdu city provides Youngshe with a good infrastructure for both industrial-scale production of peptides and custom peptide synthesis.You can select more than 200 kinds of raw cosmetic peptide ingredients here.Youngshe provide a one-stop service for raw cosmetic peptide ingredients.You will save lots of time ,energy, money and have a very pleasant experience with us.
Sermorelin CAS:86168-78-7 peptide on sale GRF(1-29) 1

Our Exhibition

Sermorelin CAS:86168-78-7 peptide on sale GRF(1-29) 2

Our Advantages


1.Competitive factory price.
2. Professionalism of production: With more than 10 years of experience in peptide production
3. Professionalism of product efficacy: We are familiar with thousands of peptides that are now available worldwide, thorough research.
4. Professionalism of service:customer satisfaction is our greatest work.
5. Reliability: We always believe that only good reputation and product quality can make a good company.
6. Flexibility:We offer a variety of peptides, liquid, freeze-dried powder etc.
7. Variety of products: We offer more than 200 cosmetic peptides, including Dipeptide, Tripeptide, Tetrapeptide, Pentapeptide, Hexapeptide, Heptapeptide, Octapeptide, Nonapeptide, Decapeptide, Copper peptide, Oligopeptide and so on.

Sermorelin CAS:86168-78-7 peptide on sale GRF(1-29) 3

Packing&Shipping
Sermorelin CAS:86168-78-7 peptide on sale GRF(1-29) 4
F&Q


Q1: How do I make an order?
A: Simply send an inquiry to contact with us and we will be happy to assist you with your order.


Q2: How to start orders or make payments?
A: Proforma invoice will be sent first after confirmation of order, enclosed our bank information.We accept T/T (Telegraphic
Transfer),credit card or Paypal.


Q3: How about delivery lead time?
A:Delivery lead time: About 3-7 days after payment confirmed. (Chinese holiday not included)


Q4:Is there a discount?
A:Different quantity has different discount.


Q5: How do you treat quality complaint?
A:First of all, our quality control will reduce the quality problem to near zero. If there is a real quality problem caused by us,
we will send you free goods for replacement or refund your loss.


Contact info.


Aileen Chen
Email: aileen@youngshechem.com
WhatsApp/Telegram/WeChat: +8619150309904

 

Contact Details
Chengdu YoungShe Chemical Co.,Ltd

Contact Person: Ms. Aileen Chen

Tel: +8619150309904

Fax: 86-28-62328193

Send your inquiry directly to us (0 / 3000)