Home Productscosmetic octapeptide 2 online manufacturer
Certification
China Chengdu YoungShe Chemical Co.,Ltd certification
I'm Online Chat Now

cosmetic octapeptide 2 online manufacture

(1000)
buy Dirucotide CAS:152074-97-0 online manufacturer

Dirucotide CAS:152074-97-0

Product Information Name: Dirucotide (also known as MBP8298) Cas No:152074-97-0 Formula: C92H141N25O26 Molecular:2013 Sequence: Asp-Glu-Asn-Pro-Val-Val-His-Phe-Phe-Lys-Asn-Ile-Val-Thr-Pro-Arg-Thr-OH Purity:98% ... Read More
2023-11-07 14:42:21
buy Dynorphin (1-17) Dynorphin (1-13) online manufacturer

Dynorphin (1-17) Dynorphin (1-13)

Product Information 1.Basic information: Name: Dynorphin (1-17), Dynorphin (1-13) Cas No: 80448-90-4; 72957-38-1 (net) Molecular: C99H155N31O23; C75H126N24O15 MF:2147.28;1603.99 Sequence:H-Tyr-Gly-Gly-Phe-Leu... Read More
2023-11-07 17:03:40
buy Doreptide CAS:90104-48-6 online manufacturer

Doreptide CAS:90104-48-6

Product Information Name: Doreptide CAS number: 90104-48-6 Molecular formula: C17H24N4O3 Molecular weight: 332.4 Note: For lab research use only Shelf Life 2 years Apperance White Powder Purity(by HPLC) 95% ... Read More
2023-11-07 17:00:51
buy Elcatonin Acetate CAS:57014-02-5 online manufacturer

Elcatonin Acetate CAS:57014-02-5

Product Information Name:Elcatonin Acetate, elcatonina, elcatonine Cas No:57014-02-5 Formula: C150H248N42O49 Molecular:3423.82 Sequence:Ser-Asn-Leu-Ser-Thr-Asu-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu... Read More
2023-11-07 17:05:37
buy Endothelin-1 online manufacturer

Endothelin-1

Product Information 1.Basic information: Name: Endothelin-1 (human, bovine, dog, mouse, porcine, rat) Acetate Cas No: 117399-94-7 (net) MF: C109H159N25O32S5 Molecular: 2491.94 Sequence:H-Cys-Ser-Cys-Ser-Ser-Leu... Read More
2023-11-07 17:15:52
buy Eledoisin Acetate CAS:69-25-0 online manufacturer

Eledoisin Acetate CAS:69-25-0

Product Information Eledoisin Acetate 1.Basic information: Name:Eledoisin Acetate Cas No:69-25-0 Formula: C54H85N13O15S Molecular:1188.39 Sequence:Pyr-Pro-Ser-Lys-Asp-Ala-Phe-Ile-Gly-Leu-Met-NH2 Purity:98% ... Read More
2023-11-07 17:10:08
buy Enfuvirtide Acetate CAS:159519-65-0 online manufacturer

Enfuvirtide Acetate CAS:159519-65-0

Product Information Name:Enfuvirtide Acetate Cas No: 159519-65-0 Formular: C204H301N51O64 Molecular:4491.87 Sequence: AC-YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF-NH2 Purity:98% Appearance: white powder Source: ... Read More
2023-11-07 17:17:55
buy Epitalon CAS:307297-39-8 online manufacturer

Epitalon CAS:307297-39-8

Product Information Basic information: Name:Epithalon TetraPeptide Other Name: Epithalon; Glycine, L-alanyl-L-a-glutamyl-L-a-aspartyl-;AEDG;Ala-Glu-Asp-Gly; Epitalon;Glycine,L-alanyl-L-a-glutamyl-L-a-aspartyl-... Read More
2023-11-07 17:18:48
buy Epobis online manufacturer

Epobis

Product Information Basic information: Name:Epobis Sequence: Asn-Glu-Asn-Ile-Thr-Val-Pro-Asp-Thr-Lys-Val-Asn-Phe-Tyr-Ala-Trp-Lys-Arg Appearance: white powder Source: synthetic MSDS and COA: available for your ... Read More
2023-11-07 17:26:44
buy Eptifibatide Acetate Cas No:148031-34-9 online manufacturer

Eptifibatide Acetate Cas No:148031-34-9

Product Information Name:Eptifibatide Acetate, eptifibatida, Eptifibatid Cas No:148031-34-9 Formula: C37H53N11O11S2 Molecular:892 Sequence:3-MERCAPTOPROPIONYL-HOMOARG-GLY-ASP-TRP-PRO-CYS-NH2 ACETATE SALT ... Read More
2023-11-08 11:10:08
Page 84 of 100|< 79 80 81 82 83 84 85 86 87 88 >|