Home Productscopper peptides online manufacturer
Certification
china Chengdu YoungShe Chemical Co.,Ltd certification
I'm Online Chat Now

copper peptides online manufacture

(1000)
buy diprotin A CAS:90614-48-5 online manufacturer

diprotin A CAS:90614-48-5

Product Information Name: diprotin A Cas No: 90614-48-5 Formula: C17H31N3O4 Molecular: 341.44 Sequence: Ile-Pro-Ile Purity:98% Appearance: white powder Source: synthetic Also known as: isoleucylprolylisoleucine... Read More
2023-11-07 14:40:50
buy Dynorphin (1-17) Dynorphin (1-13) online manufacturer

Dynorphin (1-17) Dynorphin (1-13)

Product Information 1.Basic information: Name: Dynorphin (1-17), Dynorphin (1-13) Cas No: 80448-90-4; 72957-38-1 (net) Molecular: C99H155N31O23; C75H126N24O15 MF:2147.28;1603.99 Sequence:H-Tyr-Gly-Gly-Phe-Leu... Read More
2023-11-07 17:03:40
buy Doreptide CAS:90104-48-6 online manufacturer

Doreptide CAS:90104-48-6

Product Information Name: Doreptide CAS number: 90104-48-6 Molecular formula: C17H24N4O3 Molecular weight: 332.4 Note: For lab research use only Shelf Life 2 years Apperance White Powder Purity(by HPLC) 95% ... Read More
2023-11-07 17:00:51
buy Elcatonin Acetate CAS:57014-02-5 online manufacturer

Elcatonin Acetate CAS:57014-02-5

Product Information Name:Elcatonin Acetate, elcatonina, elcatonine Cas No:57014-02-5 Formula: C150H248N42O49 Molecular:3423.82 Sequence:Ser-Asn-Leu-Ser-Thr-Asu-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu... Read More
2023-11-07 17:05:37
buy Endothelin-1 online manufacturer

Endothelin-1

Product Information 1.Basic information: Name: Endothelin-1 (human, bovine, dog, mouse, porcine, rat) Acetate Cas No: 117399-94-7 (net) MF: C109H159N25O32S5 Molecular: 2491.94 Sequence:H-Cys-Ser-Cys-Ser-Ser-Leu... Read More
2023-11-07 17:15:52
buy Epitalon CAS:307297-39-8 online manufacturer

Epitalon CAS:307297-39-8

Product Information Basic information: Name:Epithalon TetraPeptide Other Name: Epithalon; Glycine, L-alanyl-L-a-glutamyl-L-a-aspartyl-;AEDG;Ala-Glu-Asp-Gly; Epitalon;Glycine,L-alanyl-L-a-glutamyl-L-a-aspartyl-... Read More
2023-11-07 17:18:48
buy Epobis white powder for research use online manufacturer

Epobis white powder for research use

Product Information Basic information: Name:Epobis Sequence: Asn-Glu-Asn-Ile-Thr-Val-Pro-Asp-Thr-Lys-Val-Asn-Phe-Tyr-Ala-Trp-Lys-Arg Appearance: white powder Source: synthetic MSDS and COA: available for your ... Read More
2025-09-26 13:31:17
buy Hexarelin Examorelin Cas No:1140703-51-1 online manufacturer

Hexarelin Examorelin Cas No:1140703-51-1

Product Information Name:Hexarelin Cas No: 140703-51-1 Formula: C47H58N12O6 Molecular:887 Sequence: His-D-2-methyl-Trp-Ala-Trp-D-Phe-Lys-NH2 Also known as: Examorelin, 140703-51-1, UNII-09QF37C617, EP-23905, ... Read More
2023-11-08 15:29:03
buy Exenatide Acetate Cas No:141732-76-5 online manufacturer

Exenatide Acetate Cas No:141732-76-5

Product Information Name:Exenatide Acetate, Exenatida Cas No:141732-76-5 Formula: C186H286N50O62S Molecular:4246.62 Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS Purity:98% Appearance: white powder Source: ... Read More
2023-11-08 15:29:56
buy Exenatide Acetate Cas No:141732-76-5 online manufacturer

Exenatide Acetate Cas No:141732-76-5

Product Information Name: Felypressin,Felipresina, Octapressin Cas No: 56-59-7 Formula: C46H65N13O11S2 Molecular:1040 Sequence: CYS-PHE-PHE-GLN-ASN-CYS-PRO-LYS-GLY-NH2(cyclic (1-6)disulfide) Purity:98% ... Read More
2023-11-08 15:37:49
Page 88 of 100|< 83 84 85 86 87 88 89 90 91 92 >|