Home Productspeptides intermediates

Teriparatide Acetate peptide powder

Certification
China Chengdu YoungShe Chemical Co.,Ltd certification
I'm Online Chat Now

Teriparatide Acetate peptide powder

Teriparatide Acetate peptide powder
Teriparatide Acetate peptide powder Teriparatide Acetate peptide powder Teriparatide Acetate peptide powder Teriparatide Acetate peptide powder

Large Image :  Teriparatide Acetate peptide powder

Product Details:
Place of Origin: China
Brand Name: YS
Certification: ISO9001
Model Number: YSCP
Payment & Shipping Terms:
Minimum Order Quantity: 1G
Price: negotiable
Packaging Details: 1g/bottle, 10g/bottle, 100g/bottle or customized
Delivery Time: 5 days
Payment Terms: T/T,Paypal,Western Union,Money Gram
Supply Ability: bulk

Teriparatide Acetate peptide powder

Description
Apperance: White Powder Shelf Life: 2 Years
Purity: 95%~99%

Product Information

 

Name:Teriparatide Acetate, Teriparatida , Teriparatidum

Cas No: 52232-67-4(net),99294-94-7(acetate)

Formula: C181H291N55O51S2

Molecular: 4117.71

Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF

Purity:98%

Appearance: white powder

Source: synthetic

Also know as Aventis Brand of Teriparatide,Forteo,hPTH (1-34),Human Parathyroid Hormone (1-34),Lilly Brand of Teriparatide

Parathar,Teriparatide Acetate,Teriparatide Aventis Brand

 

 

Shelf Life  2 years
Apperance  White Powder
Purity(by HPLC)  ≥95%

 

Company Information
 
Chengdu Youngshe Chemical Co.,Ltd, is a dynamic and progressive peptides manufacturer in China. We are dedicating to be a professional, efficient,and reliable partner for global customers on peptides.Hi-new tech Zone campus in the suburb of Chengdu city provides Youngshe with a good infrastructure for both industrial-scale production of peptides and custom peptide synthesis.You can select more than 200 kinds of raw cosmetic peptide ingredients here.Youngshe provide a one-stop service for raw cosmetic peptide ingredients.You will save lots of time ,energy, money and have a very pleasant experience with us.
Teriparatide Acetate peptide powder 0
 
Our Advantages
 
1.Competitive factory price.
2. Professionalism of production: With more than 10 years of experience in peptide production
3. Professionalism of product efficacy: We are familiar with thousands of peptides that are now available worldwide, thorough research.
4. Professionalism of service:customer satisfaction is our greatest work.
5. Reliability: We always believe that only good reputation and product quality can make a good company.
6. Flexibility:We offer a variety of peptides, liquid, freeze-dried powder etc.
7. Variety of products: We offer more than 200 cosmetic peptides, including Dipeptide, Tripeptide, Tetrapeptide, Pentapeptide, Hexapeptide, Heptapeptide, Octapeptide, Nonapeptide, Decapeptide, Copper peptide, Oligopeptide and so on.
 
Packing&Shipping
Teriparatide Acetate peptide powder 1
 
F&Q
 
Q1: How do I make an order?
A: Simply send an inquiry to contact with us and we will be happy to assist you with your order.


Q2: How to start orders or make payments?
A: Proforma invoice will be sent first after confirmation of order, enclosed our bank information.We accept T/T (Telegraphic
Transfer),Western Union or Paypal.


Q3: How about delivery lead time?
A:Delivery lead time: About 3-5 days after payment confirmed. (Chinese holiday not included)


Q4:Is there a discount?
A:Different quantity has different discount.


Q5: How do you treat quality complaint?
A:First of all, our quality control will reduce the quality problem to near zero. If there is a real quality problem caused by us,
we will send you free goods for replacement or refund your loss.

 
 
Contact info.
Aileen Chen
Email: aileen@youngshechem.com
Tel/whatsapp/Skype/WeChat: +8619150309904

Contact Details
Chengdu YoungShe Chemical Co.,Ltd

Contact Person: Ms. Aileen Chen

Tel: +8619150309904

Fax: 86-28-62328193

Send your inquiry directly to us (0 / 3000)